PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00003.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 385aa    MW: 44464.6 Da    PI: 8.1615
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00003.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.38.7e-19175221148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g WT eEd +l+++v+++G + W+ Ia+ ++ gR +kqc++rw+++l
  Rsa1.0_00003.1_g00003.1 175 KGQWTSEEDRILIQLVEKYGLRKWSHIAQVLP-GRIGKQCRERWYNHL 221
                              799*****************************.*************97 PP

2Myb_DNA-binding513.2e-16230269445
                              S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              W++eEd  l++ +k+ G++ W+ Ia++++ gRt++++k++w+
  Rsa1.0_00003.1_g00003.1 230 WSEEEDRVLIEFHKEIGNK-WAEIAKKLP-GRTENSIKNHWN 269
                              *******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.673170225IPR017930Myb domain
SuperFamilySSF466892.88E-32173268IPR009057Homeodomain-like
SMARTSM007172.6E-18174223IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.7E-28176228IPR009057Homeodomain-like
PfamPF139212.3E-19178235No hitNo description
CDDcd001673.00E-16178221No hitNo description
SMARTSM007173.0E-15226274IPR001005SANT/Myb domain
PROSITE profilePS5129419.924226276IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-21229274IPR009057Homeodomain-like
CDDcd001674.20E-12230272No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MENYVGESGF SPLNQTILIR DQEQLKEENF PFKVVDQSKP ASFLQDFHHL DHDHHHGSIS  60
SNLLLGIQTS PSCVNFSPFE HYSCQENMVD EHGPMDMEQN NTMMMMKMIP FDYPPRGITK  120
PINFVMPYEV SCVSADNDSY KAMSLNKTKP SLTRKLSSSS SSSLCKGKEK TTLIKGQWTS  180
EEDRILIQLV EKYGLRKWSH IAQVLPGRIG KQCRERWYNH LRPDIKKEIW SEEEDRVLIE  240
FHKEIGNKWA EIAKKLPGRT ENSIKNHWNA TKRRQFSKRK CRSKYPRSFL LQDYIKSLDL  300
GALSSSSVPA RGRRRESNKK KDIRGVEEKK KNKEVVLCGQ DRIVPECVFI DDFGFNENLL  360
EEGCSIDSLL GEFPQPDIDA FAHGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-441732762105C-Myb DNA-Binding Domain
1msf_C1e-441732762105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009137122.10.0PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L20.0MYB98_ARATH; Transcription factor MYB98
TrEMBLM4D7W90.0M4D7W9_BRARP; Uncharacterized protein
STRINGBra012579.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58692847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.10.0myb domain protein 98